EP400 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA12151T
Article Name: |
EP400 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA12151T |
Supplier Catalog Number: |
CNA12151T |
Alternative Catalog Number: |
MBL-CNA12151T |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 90-330 of human EP400 (NP_056224.3). |
Conjugation: |
Unconjugated |
Alternative Names: |
P400, CAGH32, TNRC12 |
Clonality: |
Polyclonal |
Molecular Weight: |
343kDa |
NCBI: |
57634 |
Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.01% thimerosal,50% glycerol |
Sequence: |
TLAPLPLPSPTSPGFQFSAQPRRFEHGSPSYIQVTSPLSQQVQTQSPTQPSPGPGQALQNVRAGAPGPGLGLCSSSPTGGFVDASVLVRQISLSPSSGGHFVFQDGSGLTQIAQGAQVQLQHPGTPITVRERRPSQPHTQSGGTIHHLGPQSPAAAGGAGLQPLASPSHITTANLPPQISSIIQGQLVQQQQVLQGPPLPRPLGFERTPGVLLPGAGGAAGFGMTSPPPPTSPSRTAVPPG |
Target: |
EP400 |
Application Dilute: |
WB: WB,1:500 - 1:1000 |