SNRPF Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12162T
Article Name: SNRPF Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12162T
Supplier Catalog Number: CNA12162T
Alternative Catalog Number: MBL-CNA12162T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SNRPF (NP_003086.1).
Conjugation: Unconjugated
Alternative Names: SMF, Sm-F, snRNP-F
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 6636
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE
Target: SNRPF
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200