GPN1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12167T
Article Name: GPN1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12167T
Supplier Catalog Number: CNA12167T
Alternative Catalog Number: MBL-CNA12167T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 269-388 of human GPN1 (NP_009197.2).
Conjugation: Unconjugated
Alternative Names: XAB1, MBDIN, NTPBP, RPAP4, ATPBD1A
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 11321
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: FVQVTSAAEEYEREYRPEYERLKKSLANAESQQQREQLERLRKDMGSVALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNFMQESMAQYWKRNNK
Target: GPN1
Application Dilute: WB: WB,1:500 - 1:2000