PMEPA1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12171T
Article Name: PMEPA1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12171T
Supplier Catalog Number: CNA12171T
Alternative Catalog Number: MBL-CNA12171T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 173-252 of human PMEPA1 (NP_954638.1).
Conjugation: Unconjugated
Alternative Names: STAG1, TMEPAI
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 56937
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL
Target: PMEPA1
Application Dilute: WB: WB,1:500 - 1:2000