CDH11 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12176T
Article Name: CDH11 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12176T
Supplier Catalog Number: CNA12176T
Alternative Catalog Number: MBL-CNA12176T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-400 of human CDH11 (P55287).
Conjugation: Unconjugated
Alternative Names: OB, ESWS, CAD11, CDHOB, OSF-4, TBHS2
Clonality: Polyclonal
Molecular Weight: 88kDa
NCBI: 1009
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ERAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHETYHANVPERSNVGTSVIQVTASDADDPTYGNSAKLVYSILEGQPYFSVEAQTGIIRTALPNMDREAKEEYHVVIQAKDMGGHMGGLSGTTKVTITLTDVNDNPPKFPQSVYQMSVSEAAVPGEEVGRVKAKDPDIGENGLVTYNIVDGDGMESFEITTDYETQEGVIKLKKPVDFETKRAYSLKVEAANVHIDPKFISNGPFKDTVTVKIS
Target: CDH11
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200