CSMD3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12199T
Article Name: CSMD3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12199T
Supplier Catalog Number: CNA12199T
Alternative Catalog Number: MBL-CNA12199T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-440 of human CSMD3 (NP_937756.1).
Conjugation: Unconjugated
Alternative Names: CSMD3
Clonality: Polyclonal
Molecular Weight: 406kDa
NCBI: 114788
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ANSVNTASWDFPVPICRAEDACGGTMRGSSGIISSPSFPNEYHNNADCTWTIVAEPGDTISLIFTDFQMEEKYDYLEIEGSEPPTIWLSGMNIPPPIISNKNWLRLHFVTDSNHRYRGFSAPYQGSSTLTHTTSTGELEEHNRTTTGAIAVASTPADVTVSSVTAVTIHRLSEEQRVQVTSLRNSGLDPNTSKDGLSPHPADTQSTRRRPRHAEQIERTKE
Target: CSMD3
Application Dilute: WB: WB,1:500 - 1:2000