HRAS Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12212T
Article Name: HRAS Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12212T
Supplier Catalog Number: CNA12212T
Alternative Catalog Number: MBL-CNA12212T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-189 of human HRAS (NP_005334.1).
Conjugation: Unconjugated
Alternative Names: CTLO, HAMSV, HRAS1, RASH1, p21ras, C-H-RAS, H-RASIDX, C-BAS/HAS, C-HA-RAS1
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 3265
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS
Target: HRAS
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200