Aromatase (CYP19A1) Rabbit mAb, Clone: [ARC0635], Unconjugated, Monoclonal

Catalog Number: MBL-CNA12238S
Article Name: Aromatase (CYP19A1) Rabbit mAb, Clone: [ARC0635], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA12238S
Supplier Catalog Number: CNA12238S
Alternative Catalog Number: MBL-CNA12238S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aromatase (CYP19A1) (P11511).
Conjugation: Unconjugated
Alternative Names: ARO, ARO1, CPV1, CYAR, CYP19, CYPXIX, P-450AROM
Clonality: Monoclonal
Clone Designation: [ARC0635]
Molecular Weight: 58kDa
NCBI: 1588
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKS
Target: CYP19A1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200