RRBP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12239T
Article Name: RRBP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12239T
Supplier Catalog Number: CNA12239T
Alternative Catalog Number: MBL-CNA12239T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human RRBP1 (NP_004578.2).
Conjugation: Unconjugated
Alternative Names: RRp, hES, p180, ES130, ES/130
Clonality: Polyclonal
Molecular Weight: 152kDa
NCBI: 6238
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MDIYDTQTLGVVVFGGFMVVSAIGIFLVSTFSMKETSYEEALANQRKEMAKTHHQKVEKKKKEKTVEKKGKTKKKEEKPNGKIPDHDPAPNVTVLLREPVRAPAVAVAPTPVQPPIIVAPVATVPAMPQEKLASSPKDKK
Target: RRBP1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200