ARHGAP25 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1223S
Article Name: ARHGAP25 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1223S
Supplier Catalog Number: CNA1223S
Alternative Catalog Number: MBL-CNA1223S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-370 of human ARHGAP25 (NP_001159748.1).
Conjugation: Unconjugated
Alternative Names: KAIA0053, HEL-S-308
Clonality: Polyclonal
Molecular Weight: 73kDa
NCBI: 9938
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MSLGQSACLFLSIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQ
Target: ARHGAP25
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100