SHARPIN Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12240P
Article Name: SHARPIN Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12240P
Supplier Catalog Number: CNA12240P
Alternative Catalog Number: MBL-CNA12240P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human SHARPIN (NP_112236.3).
Conjugation: Unconjugated
Alternative Names: SIPL1
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 81858
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNGSKSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLT
Target: SHARPIN
Application Dilute: WB: WB,1:500 - 1:1000