PORCN Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12250T
Article Name: PORCN Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12250T
Supplier Catalog Number: CNA12250T
Alternative Catalog Number: MBL-CNA12250T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-320 of human PORCN (NP_982299.1).
Conjugation: Unconjugated
Alternative Names: PPN, DHOF, FODH, MG61, PORC
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 64840
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PLNGDRLLRNKKRKARWLRAYESAVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNALRLG
Target: PORCN
Application Dilute: WB: WB,1:500 - 1:1000