AP2S1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12270T
Article Name: AP2S1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12270T
Supplier Catalog Number: CNA12270T
Alternative Catalog Number: MBL-CNA12270T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human AP2S1 (NP_004060.2).
Conjugation: Unconjugated
Alternative Names: AP17, FBH3, HHC3, FBHOk, CLAPS2
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 1175
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Target: AP2S1
Application Dilute: WB: WB,1:500 - 1:2000