ERH Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12271T
Article Name: ERH Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12271T
Supplier Catalog Number: CNA12271T
Alternative Catalog Number: MBL-CNA12271T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human ERH (NP_004441.1).
Conjugation: Unconjugated
Alternative Names: DROER
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 2079
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Target: ERH
Application Dilute: WB: WB,1:500 - 1:2000