DPYSL3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12280T
Article Name: DPYSL3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12280T
Supplier Catalog Number: CNA12280T
Alternative Catalog Number: MBL-CNA12280T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 440-520 of human DPYSL3 (NP_001378.1).
Conjugation: Unconjugated
Alternative Names: DRP3, ULIP, CRMP4, DRP-3, LCRMP, CRMP-4, ULIP-1
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 1809
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: RGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSAR
Target: DPYSL3
Application Dilute: WB: WB,1:500 - 1:2000