Snail Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12301T
Article Name: Snail Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12301T
Supplier Catalog Number: CNA12301T
Alternative Catalog Number: MBL-CNA12301T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human Snail (O95863).
Conjugation: Unconjugated
Alternative Names: SNA, SNAH, SNAIL, SLUGH2, SNAIL1, dJ710H13.1
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 6615
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKH
Target: SNAI1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200