GLUT2/SLC2A2 Rabbit mAb, Clone: [ARC0305], Unconjugated, Monoclonal

Catalog Number: MBL-CNA12307S
Article Name: GLUT2/SLC2A2 Rabbit mAb, Clone: [ARC0305], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA12307S
Supplier Catalog Number: CNA12307S
Alternative Catalog Number: MBL-CNA12307S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GLUT2/SLC2A2 (P11168).
Conjugation: Unconjugated
Alternative Names: GLUT2
Clonality: Monoclonal
Clone Designation: [ARC0305]
Molecular Weight: 57kDa
NCBI: 6514
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLS
Target: SLC2A2
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200