NOX1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12309T
Article Name: NOX1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12309T
Supplier Catalog Number: CNA12309T
Alternative Catalog Number: MBL-CNA12309T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human NOX1 (NP_008983.2).
Conjugation: Unconjugated
Alternative Names: MOX1, NOH1, NOH-1, GP91-2, NOH-1L
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 27035
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: YFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKV
Target: NOX1
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200