CD127/IL7R Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA1230P
Article Name: |
CD127/IL7R Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA1230P |
Supplier Catalog Number: |
CNA1230P |
Alternative Catalog Number: |
MBL-CNA1230P |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 21-239 of human CD127/IL7R (NP_002176.2). |
Conjugation: |
Unconjugated |
Alternative Names: |
ILRA, CD127, IL7RA, CDW127, IMD104, sIL-7R, lnc-IL7R, IL7Ralpha, IL-7Ralpha, IL-7R-alpha |
Clonality: |
Polyclonal |
Molecular Weight: |
52kDa |
NCBI: |
3575 |
Buffer: |
PBS with 0.05% proclin300,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.05% proclin300,50% glycerol |
Sequence: |
ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMD |
Target: |
IL7R |
Application Dilute: |
WB: WB,1:500 - 1:1000 |