MAP1LC3A Rabbit mAb, Clone: [ARC2636], Unconjugated, Monoclonal

Catalog Number: MBL-CNA12319S
Article Name: MAP1LC3A Rabbit mAb, Clone: [ARC2636], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA12319S
Supplier Catalog Number: CNA12319S
Alternative Catalog Number: MBL-CNA12319S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IP, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAP1LC3A (Q9H492).
Conjugation: Unconjugated
Alternative Names: LC3, LC3A, ATG8E, MAP1ALC3, MAP1BLC3
Clonality: Monoclonal
Clone Designation: [ARC2636]
Molecular Weight: 14kDa
NCBI: 84557
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYE
Target: MAP1LC3A
Application Dilute: WB: WB,1:500 - 1:1000|IP,1:50- 1:1200