CDC20 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1231S
Article Name: CDC20 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1231S
Supplier Catalog Number: CNA1231S
Alternative Catalog Number: MBL-CNA1231S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human CDC20 (NP_001246.2).
Conjugation: Unconjugated
Alternative Names: CDC20A, OOMD14, p55CDC, OZEMA14, bA276H19.3
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 991
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWD
Target: CDC20
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200