MFGE8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12322T
Article Name: MFGE8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12322T
Supplier Catalog Number: CNA12322T
Alternative Catalog Number: MBL-CNA12322T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human MFGE8 (NP_001108086.1).
Conjugation: Unconjugated
Alternative Names: BA46, HMFG, MFGM, SED1, hP47, EDIL1, MFG-E8, SPAG10, OAcGD3S, HsT19888
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 4240
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPV
Target: MFGE8
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200