LGR5/GPR49 Rabbit mAb, Clone: [ARC0321], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA12327S
Article Name: |
LGR5/GPR49 Rabbit mAb, Clone: [ARC0321], Unconjugated, Monoclonal |
Biozol Catalog Number: |
MBL-CNA12327S |
Supplier Catalog Number: |
CNA12327S |
Alternative Catalog Number: |
MBL-CNA12327S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 800-907 of human LGR5/GPR49 (O75473). |
Conjugation: |
Unconjugated |
Alternative Names: |
FEX, HG38, GPR49, GPR67, GRP49 |
Clonality: |
Monoclonal |
Clone Designation: |
[ARC0321] |
Molecular Weight: |
100kDa |
NCBI: |
8549 |
Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequence: |
VIKFILLVVVPLPACLNPLLYILFNPHFKEDLVSLRKQTYVWTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSSVAFVPCL |
Target: |
LGR5 |
Application Dilute: |
WB: WB,1:500 - 1:2000 |