VEGFR3/FLT4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12332T
Article Name: VEGFR3/FLT4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12332T
Supplier Catalog Number: CNA12332T
Alternative Catalog Number: MBL-CNA12332T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human VEGFR3/FLT4 (NP_891555.2).
Conjugation: Unconjugated
Alternative Names: PCL, CHTD7, FLT-4, FLT41, LMPH1A, LMPHM1, VEGFR3, VEGFR-3
Clonality: Polyclonal
Molecular Weight: 153kDa
NCBI: 2324
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: SQVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPMTPTTYKGSVDNQTDSGMVLASEEFEQIESRHRQESGFSCK
Target: FLT4
Application Dilute: WB: WB,1:500 - 1:2000