KLRC1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1233S
Article Name: KLRC1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1233S
Supplier Catalog Number: CNA1233S
Alternative Catalog Number: MBL-CNA1233S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 96-215 of human KLRC1 (NP_015567.1).
Conjugation: Unconjugated
Alternative Names: NKG2, NKG2A, CD159A
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 3821
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: RHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL
Target: KLRC1
Application Dilute: WB: WB,1:500 - 1:2000