MYBPC3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12351S
Article Name: MYBPC3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12351S
Supplier Catalog Number: CNA12351S
Alternative Catalog Number: MBL-CNA12351S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-400 of human MYBPC3 (NP_000247.2).
Conjugation: Unconjugated
Alternative Names: FHC, CMH4, CMD1MM, LVNC10, MYBP-C, cMyBP-C
Clonality: Polyclonal
Molecular Weight: 141kDa
NCBI: 4607
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: SSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNG
Target: MYBPC3
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200