SBF1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12354T
Article Name: SBF1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12354T
Supplier Catalog Number: CNA12354T
Alternative Catalog Number: MBL-CNA12354T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1630-1770 of human SBF1 (NP_002963.2).
Conjugation: Unconjugated
Alternative Names: MTMR5, CMT4B3, DENND7A
Clonality: Polyclonal
Molecular Weight: 208kDa
NCBI: 6305
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: PPYDWELAQGPPEPPEEERSDGGAPQSRRRVVWPCYDSCPRAQPDAISRLLEELQRLETELGQPAERWKDTWDRVKAAQRLEGRPDGRGTPSSLLVSTAPHHRRSLGVYLQEGPVGSTLSLSLDSDQSSGSTTSGSRQAAR
Target: SBF1
Application Dilute: WB: WB,1:500 - 1:2000