alpha 1 Spectrin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12355T
Article Name: alpha 1 Spectrin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12355T
Supplier Catalog Number: CNA12355T
Alternative Catalog Number: MBL-CNA12355T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 940-1160 of human alpha 1 Spectrin (NP_003117.2).
Conjugation: Unconjugated
Alternative Names: EL2, HPP, HS3, SPH3, SPTA
Clonality: Polyclonal
Molecular Weight: 280kDa
NCBI: 6708
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KHEAFLLDLNSFGDSMKALRNQANACQQQQAAPVEGVAGEQRVMALYDFQARSPREVTMKKGDVLTLLSSINKDWWKVEAADHQGIVPAVYVRRLAHDEFPMLPQRRREEPGNITQRQEQIENQYRSLLDRAEERRRRLLQRYNEFLLAYEAGDMLEWIQEKKAENTGVELDDVWELQKKFDEFQKDLNTNEPRLRDINKVADDLLFEGLLTPEGAQIRQE
Target: SPTA1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200