STAT5B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12356T
Article Name: STAT5B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12356T
Supplier Catalog Number: CNA12356T
Alternative Catalog Number: MBL-CNA12356T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-787 of human STAT5B (NP_036580.2).
Conjugation: Unconjugated
Alternative Names: STAT5, GHISID2
Clonality: Polyclonal
Molecular Weight: 90kDa
NCBI: 6777
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: VKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS
Target: STAT5B
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200