SULT1A3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12357T
Article Name: SULT1A3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12357T
Supplier Catalog Number: CNA12357T
Alternative Catalog Number: MBL-CNA12357T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SULT1A3 (NP_808220.1).
Conjugation: Unconjugated
Alternative Names: STM, HAST, HAST3, M-PST, ST1A3, ST1A4, ST1A5, TL-PST, ST1A3/ST1A4
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 6818
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTP
Target: SULT1A3
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100