UBA1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12359T
Article Name: UBA1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12359T
Supplier Catalog Number: CNA12359T
Alternative Catalog Number: MBL-CNA12359T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 300-600 of human UBA1 (NP_695012.1).
Conjugation: Unconjugated
Alternative Names: A1S9, A1ST, GXP1, UBE1, A1S9T, AMCX1, POC20, SMAX2, UBA1A, UBE1X, VEXAS, CFAP124
Clonality: Polyclonal
Molecular Weight: 118kDa
NCBI: 7317
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KISFKSLVASLAEPDFVVTDFAKFSRPAQLHIGFQALHQFCAQHGRPPRPRNEEDAAELVALAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKFMPIMQWLYFDALECLPEDKEVLTEDKCLQRQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIGCELLKNFAMIGLGCGEGGEIIVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMNPHIRVTSHQNRVG
Target: UBA1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200