GEMIN6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12375T
Article Name: GEMIN6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12375T
Supplier Catalog Number: CNA12375T
Alternative Catalog Number: MBL-CNA12375T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human GEMIN6 (NP_079051.9).
Conjugation: Unconjugated
Alternative Names: GEMIN6
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 79833
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYGPENCSSSNEIILSRVQDLIEGHLTASQ
Target: GEMIN6
Application Dilute: WB: WB,1:500 - 1:2000