CD3D Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1238S
Article Name: CD3D Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1238S
Supplier Catalog Number: CNA1238S
Alternative Catalog Number: MBL-CNA1238S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-105 of human CD3D (NP_000723.1).
Conjugation: Unconjugated
Alternative Names: T3D, IMD19, CD3DELTA, CD3-DELTA
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 915
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
Target: CD3D
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100