AIF1/IBA1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12391P
Article Name: AIF1/IBA1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12391P
Supplier Catalog Number: CNA12391P
Alternative Catalog Number: MBL-CNA12391P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human AIF1/IBA1 (NP_001614.3).
Conjugation: Unconjugated
Alternative Names: IBA1, IRT1, AIF-1, IRT-1
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 199
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Target: AIF1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:200