CGA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1239S
Article Name: CGA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1239S
Supplier Catalog Number: CNA1239S
Alternative Catalog Number: MBL-CNA1239S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-116 of human CGA (NP_000726.1).
Conjugation: Unconjugated
Alternative Names: HCG, LHA, FSHA, GPA1, GPHa, TSHA, GPHA1, CG-ALPHA
Clonality: Polyclonal
Molecular Weight: 13kDa
NCBI: 1081
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Target: CGA
Application Dilute: WB: WB,1:500 - 1:2000