ATP1B1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12403T
Article Name: ATP1B1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12403T
Supplier Catalog Number: CNA12403T
Alternative Catalog Number: MBL-CNA12403T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 65-240 of human ATP1B1 (NP_001668.1).
Conjugation: Unconjugated
Alternative Names: ATP1B
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 481
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: KPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPL
Target: ATP1B1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200