DNA topoisomerase I (TOP1) Rabbit mAb, Clone: [ARC0708], Unconjugated, Monoclonal

Catalog Number: MBL-CNA12409S
Article Name: DNA topoisomerase I (TOP1) Rabbit mAb, Clone: [ARC0708], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA12409S
Supplier Catalog Number: CNA12409S
Alternative Catalog Number: MBL-CNA12409S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (TOP1) (P11387).
Conjugation: Unconjugated
Alternative Names: TOPI
Clonality: Monoclonal
Clone Designation: [ARC0708]
Molecular Weight: 91kDa
NCBI: 7150
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
Target: TOP1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000