CD59 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA12412S
| Article Name: |
CD59 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA12412S |
| Supplier Catalog Number: |
CNA12412S |
| Alternative Catalog Number: |
MBL-CNA12412S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 26-128 of human CD59 (NP_001120695.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
1F5, EJ16, EJ30, EL32, G344, MIN1, MIN2, MIN3, MIRL, HRF20, MACIF, MEM43, MIC11, MSK21, 16.3A5, HRF-20, MAC-IP, p18-20 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
14kDa |
| NCBI: |
966 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP |
| Target: |
CD59 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
