CD3E Antigen Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12415S
Article Name: CD3E Antigen Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12415S
Supplier Catalog Number: CNA12415S
Alternative Catalog Number: MBL-CNA12415S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CD3E Antigen (NP_000724.1).
Conjugation: Unconjugated
Alternative Names: T3E, TCRE, IMD18, CD3epsilon
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 916
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Target: CD3E
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200