CGB Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12419S
Article Name: CGB Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12419S
Supplier Catalog Number: CNA12419S
Alternative Catalog Number: MBL-CNA12419S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-165 of human CGB (NP_000728.1).
Conjugation: Unconjugated
Alternative Names: CGB, LHB, CGB5, CGB7, CGB8, hCGB
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 1082
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Target: CGB3
Application Dilute: WB: WB,1:1000 - 1:5000