Clathrin heavy chain Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12423T
Article Name: Clathrin heavy chain Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12423T
Supplier Catalog Number: CNA12423T
Alternative Catalog Number: MBL-CNA12423T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1451-1675 of human Clathrin heavy chain (NP_004850.1).
Conjugation: Unconjugated
Alternative Names: Hc, CHC, CHC17, MRD56, CLH-17, CLTCL2
Clonality: Polyclonal
Molecular Weight: 192kDa
NCBI: 1213
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: YLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
Target: CLTC
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200