PCNA Rabbit mAb, Clone: [ARC51324], Unconjugated, Monoclonal

Catalog Number: MBL-CNA12427P
Article Name: PCNA Rabbit mAb, Clone: [ARC51324], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA12427P
Supplier Catalog Number: CNA12427P
Alternative Catalog Number: MBL-CNA12427P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Monkey, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 162-261 of human PCNA (NP_002583.1).
Conjugation: Unconjugated
Alternative Names: ATLD2
Clonality: Monoclonal
Clone Designation: [ARC51324]
Molecular Weight: 29kDa
NCBI: 5111
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: CAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Target: PCNA
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:2000 - 1:10000|IF/ICC,1:50 - 1:200