PRSS1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1242S
Article Name: PRSS1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1242S
Supplier Catalog Number: CNA1242S
Alternative Catalog Number: MBL-CNA1242S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-247 of human PRSS1 (NP_002760.1).
Conjugation: Unconjugated
Alternative Names: TRP1, TRY1, TRY4, TRYP1
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 5644
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Target: PRSS1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200