FLT3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA12437S
| Article Name: |
FLT3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA12437S |
| Supplier Catalog Number: |
CNA12437S |
| Alternative Catalog Number: |
MBL-CNA12437S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC-P, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 650-750 of human FLT3 (NP_004110.2). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
FLK2, STK1, CD135, FLK-2 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
113kDa |
| NCBI: |
2322 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
ADSSEREALMSELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSD |
| Target: |
FLT3 |
| Application Dilute: |
WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200 |
