Granulin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12440S
Article Name: Granulin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12440S
Supplier Catalog Number: CNA12440S
Alternative Catalog Number: MBL-CNA12440S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 281-336 of human Granulin (NP_002078.1).
Conjugation: Unconjugated
Alternative Names: GEP, GP88, PEPI, PGRN, CLN11, PCDGF
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 2896
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: DVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCE
Target: GRN
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200