GTF2I Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12441S
Article Name: GTF2I Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12441S
Supplier Catalog Number: CNA12441S
Alternative Catalog Number: MBL-CNA12441S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 600-810 of human GTF2I (NP_001157108.1).
Conjugation: Unconjugated
Alternative Names: WBS, DIWS, SPIN, IB291, BAP135, BTKAP1, TFII-I, WBSCR6, GTFII-I
Clonality: Polyclonal
Molecular Weight: 112kDa
NCBI: 2969
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: TWFGIPRLERIVRGSNKIKFVVKKPELVISYLPPGMASKINTKALQSPKRPRSPGSNSKVPEIEVTVEGPNNNNPQTSAVRTPTQTNGSNVPFKPRGREFSFEAWNAKITDLKQKVENLFNEKCGEALGLKQAVKVPFALFESFPEDFYVEGLPEGVPFRRPSTFGIPRLEKILRNKAKIKFIIKKPEMFETAIKESTSSKSPPRKINSSP
Target: GTF2I
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100