IGFBP5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12451S
Article Name: IGFBP5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12451S
Supplier Catalog Number: CNA12451S
Alternative Catalog Number: MBL-CNA12451S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 68-167 of human IGFBP5 (NP_000590.1).
Conjugation: Unconjugated
Alternative Names: IBP5
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 3488
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: GVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVG
Target: IGFBP5
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200