IL17A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12454P
Article Name: IL17A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12454P
Supplier Catalog Number: CNA12454P
Alternative Catalog Number: MBL-CNA12454P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL17A (NP_002181.1).
Conjugation: Unconjugated
Alternative Names: IL17, CTLA8, IL-17, ILA17, CTLA-8, IL-17A
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 3605
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCI
Target: IL17A
Application Dilute: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:100 - 1:300