MAP3K5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12458T
Article Name: MAP3K5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12458T
Supplier Catalog Number: CNA12458T
Alternative Catalog Number: MBL-CNA12458T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human MAP3K5 (NP_005914.1).
Conjugation: Unconjugated
Alternative Names: ASK1, MEKK5, MAPKKK5
Clonality: Polyclonal
Molecular Weight: 155kDa
NCBI: 4217
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MSTEADEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESAAAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVAYVINEASQGQLVVAESEALQSLREACETVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFR
Target: MAP3K5
Application Dilute: WB: WB,1:500 - 1:1000