PPP1CA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA12468P
Article Name: PPP1CA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA12468P
Supplier Catalog Number: CNA12468P
Alternative Catalog Number: MBL-CNA12468P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human PPP1CA (NP_002699.1).
Conjugation: Unconjugated
Alternative Names: PP1A, PP-1A, PPP1A, PP1alpha
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 5499
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDG
Target: PPP1CA
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200